TB-500: research overview
TB-500 is a synthetic form of thymosin beta-4, a naturally occurring peptide built from 43 amino acids. Thymosin beta-4 belongs to the thymosin family and is a well-characterised actin-binding protein in cell biology. Our research peptide reproduces the full 43-residue sequence, and its molecular mass of 4963.5 g/mol is confirmed by mass spectrometry. Supplied for laboratory research use only.
Mechanism described in research
In vitro studies have described how thymosin beta-4 binds monomeric G-actin and influences cytoskeletal dynamics. This interaction is linked to the cell migration observed in culture. In animal models, researchers have described the peptide’s involvement in the formation of new blood vessels and the repair of damaged tissue. Outcomes depend strongly on the model and conditions, which is why a controlled experimental design matters.
Research areas
- cell migration and motility in in vitro cultures
- cytoskeletal dynamics and actin binding
- angiogenesis in vascular models
- soft tissue injury models in animal studies
- muscle and tendon tissue in preclinical research
Product specification
| Parameter | Value |
|---|---|
| Name | TB-500 |
| CAS number | 77591-33-4 |
| Molecular formula | C212H350N56O78S |
| Molecular mass | 4963.5 g/mol |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids) |
| Form | lyophilisate |
| Purity | ≥ 99% (HPLC) |
| Available sizes | 2 mg, 5 mg, 10 mg |
Laboratory handling
Reconstitution and storage
- Store the lyophilised material at -20 °C, tightly sealed and protected from moisture.
- Let the vial reach room temperature before opening to limit condensation.
- Once reconstituted, keep the solution at 2-8 °C.
- Avoid repeated freeze-thaw cycles. Divide the solution into smaller working portions.
Bacteriostatic water as a solvent
Bacteriostatic water is often used in the laboratory to reconstitute lyophilised peptides, as it helps limit microbial growth in working solutions. It is available in our shop as a separate product. The choice of solvent should always follow your research protocol.
Batch quality
Every batch undergoes HPLC analysis confirming purity of ≥ 99%. Molecular mass is verified by mass spectrometry (MS).
- purity of ≥ 99%, confirmed by HPLC
- molecular mass confirmed by MS
Read the full quality page for details on our testing.
Delivery
Orders placed by 14:00 on a working day ship the same day. In Poland, choose an InPost Paczkomat parcel locker with next working day delivery. Across Europe, a DPD courier delivers within 2-4 working days to 29 countries. Delivery is free on orders from 75 EUR, 65 GBP or 80 USD. Pay online by card, Apple Pay, Google Pay or BLIK (PLN only). Details are on the shipping page.
Related products and tools
- BPC-157, a peptide often studied alongside TB-500 in tissue research
- BPC-157 + TB-500, a product combining both peptides
- Bacteriostatic water for preparing working solutions
- Concentration calculator to work out your working concentration
- Thymosin alpha-1, a thymosin family peptide studied in immunology
- KPV, a tripeptide fragment of alpha-MSH studied in inflammation models
